PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00018444-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family NF-YB
Protein Properties Length: 136aa    MW: 15470 Da    PI: 4.5276
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00018444-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB159.84e-50498397
               NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                        eq+r+lPianv+rimk++lPa akisk+aket+qec +efisfvt+easdkc++e+rkt+ngdd++wal+tlGf++y e++  yl kyre+e+
  WALNUT_00018444-RA  4 EQERLLPIANVGRIMKQILPATAKISKEAKETLQECSTEFISFVTAEASDKCHKENRKTVNGDDICWALSTLGFDNYSEAMVRYLYKYREAER 96
                        89******************************************************************************************9 PP

               NF-YB 96 ek 97
                        +k
  WALNUT_00018444-RA 97 QK 98
                        86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.3E-503132IPR009072Histone-fold
SuperFamilySSF471131.04E-385127IPR009072Histone-fold
PfamPF008086.1E-26872IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006159.1E-183654No hitNo description
PRINTSPR006159.1E-185573No hitNo description
PRINTSPR006159.1E-187492No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MDDEQERLLP IANVGRIMKQ ILPATAKISK EAKETLQECS TEFISFVTAE ASDKCHKENR  60
KTVNGDDICW ALSTLGFDNY SEAMVRYLYK YREAERQKPD QNKAGSSNPD QDKQQLEESN  120
YGNDQLGKQN NEDPSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B7e-40493392Transcription factor HapC (Eurofung)
4g92_B7e-40493392Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007030959.13e-64Nuclear transcription factor Y subunit B-4
SwissprotO040272e-56NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLA0A061F3313e-64A0A061F331_THECC; Nuclear transcription factor Y subunit B-4
STRINGVIT_14s0060g02660.t013e-60(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.11e-57nuclear factor Y, subunit B4